Lineage for d1pgp_1 (1pgp 177-473)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5520Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
  4. 5521Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (6 families) (S)
  5. 5522Family a.100.1.1: 6-phosphogluconate dehydrogenase (6PGD) [48180] (1 protein)
  6. 5523Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species)
  7. 5524Species Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries)
  8. 5527Domain d1pgp_1: 1pgp 177-473 [18780]
    Other proteins in same PDB: d1pgp_2

Details for d1pgp_1

PDB Entry: 1pgp (more details), 2.5 Å

PDB Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism

SCOP Domain Sequences for d1pgp_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgp_1 a.100.1.1 (177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries)}
gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita
silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag
ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg

SCOP Domain Coordinates for d1pgp_1:

Click to download the PDB-style file with coordinates for d1pgp_1.
(The format of our PDB-style files is described here.)

Timeline for d1pgp_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgp_2