![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins) Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain |
![]() | Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species) duplication; contains two structural repeats |
![]() | Species Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries) |
![]() | Domain d1pgpa1: 1pgp A:177-473 [18780] Other proteins in same PDB: d1pgpa2 complexed with 6pg, so4 multiple common domains: applies to families that are inconsistently divided into domains |
PDB Entry: 1pgp (more details), 2.5 Å
SCOPe Domain Sequences for d1pgpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pgpa1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg
Timeline for d1pgpa1: