Lineage for d1pgoa1 (1pgo A:177-473)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334423Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (3 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 2334424Protein 6-phosphogluconate dehydrogenase (6PGD) [48181] (2 species)
    duplication; contains two structural repeats
  7. 2334425Species Sheep (Ovis orientalis aries) [TaxId:9940] [48182] (5 PDB entries)
  8. 2334429Domain d1pgoa1: 1pgo A:177-473 [18779]
    Other proteins in same PDB: d1pgoa2
    complexed with ndp, so4

Details for d1pgoa1

PDB Entry: 1pgo (more details), 2.5 Å

PDB Description: crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for nadp specificity and the enzyme mechanism
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase

SCOPe Domain Sequences for d1pgoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgoa1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]}
gaghfvkmvhngieygdmqliceayhlmkdvlglghkemakafeewnkteldsflieita
silkfqdadgkhllpkirdsagqkgtgkwtaisaleygvpvtligeavfarclsslkder
iqaskklkgpqnipfegdkksfledirkalyaskiisyaqgfmllrqaatefgwtlnygg
ialmwrggciirsvflgkikdafdrnpglqnlllddffksavencqdswrraistgvqag
ipmpcfttalsfydgyrhamlpanliqaqrdyfgahtyellakpgqfihtnwtghgg

SCOPe Domain Coordinates for d1pgoa1:

Click to download the PDB-style file with coordinates for d1pgoa1.
(The format of our PDB-style files is described here.)

Timeline for d1pgoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgoa2