Lineage for d1dnpb1 (1dnp B:201-469)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155181Fold a.99: FAD-binding (C-terminal) domain of DNA photolyase [48172] (1 superfamily)
  4. 155182Superfamily a.99.1: FAD-binding (C-terminal) domain of DNA photolyase [48173] (1 family) (S)
  5. 155183Family a.99.1.1: FAD-binding (C-terminal) domain of DNA photolyase [48174] (1 protein)
  6. 155184Protein FAD-binding (C-terminal) domain of DNA photolyase [48175] (3 species)
  7. 155187Species Escherichia coli [TaxId:562] [48176] (1 PDB entry)
  8. 155189Domain d1dnpb1: 1dnp B:201-469 [18776]
    Other proteins in same PDB: d1dnpa2, d1dnpb2

Details for d1dnpb1

PDB Entry: 1dnp (more details), 2.3 Å

PDB Description: structure of deoxyribodipyrimidine photolyase

SCOP Domain Sequences for d1dnpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dnpb1 a.99.1.1 (B:201-469) FAD-binding (C-terminal) domain of DNA photolyase {Escherichia coli}
pveekaaiaqlrqfcqngageyeqqrdfpavegtsrlsaslatgglsprqclhrllaeqp
qaldggagsvwlneliwrefyrhlityhpslckhrpfiawtdrvqwqsnpahlqawqegk
tgypivdaamrqlnstgwmhnrlrmitasflvkdllidwregeryfmsqlidgdlaanng
gwqwaastgtdaapyfrifnpttqgekfdhegefirqwlpelrdvpgkvvhepwkwaqka
gvtldypqpivehkearvqtlaayeaark

SCOP Domain Coordinates for d1dnpb1:

Click to download the PDB-style file with coordinates for d1dnpb1.
(The format of our PDB-style files is described here.)

Timeline for d1dnpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dnpb2