SCOP 1.55: Domain d2r1ra1: 2r1r A:5-221

Lineage for d2r1ra1 (2r1r A:5-221)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)

7. Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)

8. Domain d2r1ra1: 2r1r A:5-221 [18769]
   Other proteins in same PDB: d2r1ra2, d2r1rb2, d2r1rc2

Details for d2r1ra1

PDB Entry: 2r1r, 3 Å

PDB Description: ribonucleotide reductase r1 protein with dttp occupying the specificity site from escherichia coli

SCOP Domain Sequences for d2r1ra1:

Sequence; same for both SEQRES and ATOM records:

>d2r1ra1 a.98.1.1 (A:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d2r1ra1:

• d2r1ra1 appears in SCOP 1.57
  
• d2r1ra1 appears in the current release, SCOPe 2.08