Lineage for d3r1rc1 (3r1r C:5-221)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446335Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 446336Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 446337Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 446338Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 446339Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
  8. 446358Domain d3r1rc1: 3r1r C:5-221 [18768]
    Other proteins in same PDB: d3r1ra2, d3r1rb2, d3r1rc2

Details for d3r1rc1

PDB Entry: 3r1r (more details), 3 Å

PDB Description: ribonucleotide reductase r1 protein with amppnp occupying the activity site from escherichia coli

SCOP Domain Sequences for d3r1rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r1rc1 a.98.1.1 (C:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOP Domain Coordinates for d3r1rc1:

Click to download the PDB-style file with coordinates for d3r1rc1.
(The format of our PDB-style files is described here.)

Timeline for d3r1rc1: