SCOPe 2.05: Domain d3r1rb1: 3r1r B:5-221

Lineage for d3r1rb1 (3r1r B:5-221)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
   Uniprot Q08698

8. Domain d3r1rb1: 3r1r B:5-221 [18767]
   Other proteins in same PDB: d3r1ra2, d3r1rb2, d3r1rc2
   complexed with atp

Details for d3r1rb1

PDB Entry: 3r1r, 3 Å

PDB Description: ribonucleotide reductase r1 protein with amppnp occupying the activity site from escherichia coli

PDB Compounds: (B:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d3r1rb1:

Sequence; same for both SEQRES and ATOM records:

>d3r1rb1 a.98.1.1 (B:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d3r1rb1:

• d3r1rb1 first appeared (with stable ids) in SCOP 1.55
  
• d3r1rb1 appears in SCOPe 2.04
  
• d3r1rb1 appears in SCOPe 2.06
  
• d3r1rb1 appears in the current release, SCOPe 2.08