Lineage for d3r1rb1 (3r1r B:5-221)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920124Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 920125Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 920126Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 920127Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 920128Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
    Uniprot Q08698
  8. 920146Domain d3r1rb1: 3r1r B:5-221 [18767]
    Other proteins in same PDB: d3r1ra2, d3r1rb2, d3r1rc2
    complexed with atp

Details for d3r1rb1

PDB Entry: 3r1r (more details), 3 Å

PDB Description: ribonucleotide reductase r1 protein with amppnp occupying the activity site from escherichia coli
PDB Compounds: (B:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d3r1rb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r1rb1 a.98.1.1 (B:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOPe Domain Coordinates for d3r1rb1:

Click to download the PDB-style file with coordinates for d3r1rb1.
(The format of our PDB-style files is described here.)

Timeline for d3r1rb1: