SCOP 1.73: Domain d3r1ra1: 3r1r A:5-221

Lineage for d3r1ra1 (3r1r A:5-221)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)

8. Domain d3r1ra1: 3r1r A:5-221 [18766]
   Other proteins in same PDB: d3r1ra2, d3r1rb2, d3r1rc2

Details for d3r1ra1

PDB Entry: 3r1r, 3 Å

PDB Description: ribonucleotide reductase r1 protein with amppnp occupying the activity site from escherichia coli

PDB Compounds: (A:) ribonucleotide reductase r1 protein

SCOP Domain Sequences for d3r1ra1:

Sequence; same for both SEQRES and ATOM records:

>d3r1ra1 a.98.1.1 (A:5-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
llvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiik
aaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyt
eeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsny
pretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d3r1ra1:

• d3r1ra1 first appeared (with stable ids) in SCOP 1.55
  
• d3r1ra1 appears in SCOP 1.71
  
• d3r1ra1 appears in SCOP 1.75
  
• d3r1ra1 appears in the current release, SCOPe 2.08