| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
| Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
| Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
| Species Escherichia coli [TaxId:562] [48171] (8 PDB entries) Uniprot Q08698 |
| Domain d7r1rb1: 7r1r B:1-221 [18764] Other proteins in same PDB: d7r1ra2, d7r1rb2, d7r1rc2 mutant |
PDB Entry: 7r1r (more details), 3.1 Å
SCOPe Domain Sequences for d7r1rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7r1rb1 a.98.1.1 (B:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d7r1rb1:
View in 3DDomains from other chains: (mouse over for more information) d7r1ra1, d7r1ra2, d7r1rc1, d7r1rc2 |