SCOP 1.71: Domain d7r1ra1: 7r1r A:1-221

Lineage for d7r1ra1 (7r1r A:1-221)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)

8. Domain d7r1ra1: 7r1r A:1-221 [18763]
   Other proteins in same PDB: d7r1ra2, d7r1rb2, d7r1rc2

Details for d7r1ra1

PDB Entry: 7r1r, 3.1 Å

PDB Description: ribonucleotide reductase e441q mutant r1 protein from escherichia coli

SCOP Domain Sequences for d7r1ra1:

Sequence; same for both SEQRES and ATOM records:

>d7r1ra1 a.98.1.1 (A:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d7r1ra1:

• d7r1ra1 first appeared (with stable ids) in SCOP 1.55
  
• d7r1ra1 appears in SCOP 1.69
  
• d7r1ra1 appears in SCOP 1.73
  
• d7r1ra1 appears in the current release, SCOPe 2.08