Lineage for d6r1ra1 (6r1r A:1-221)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 920124Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 920125Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 920126Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 920127Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 920128Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)
    Uniprot Q08698
  8. 920136Domain d6r1ra1: 6r1r A:1-221 [18760]
    Other proteins in same PDB: d6r1ra2, d6r1rb2, d6r1rc2
    mutant

Details for d6r1ra1

PDB Entry: 6r1r (more details), 3.1 Å

PDB Description: ribonucleotide reductase e441d mutant r1 protein from escherichia coli
PDB Compounds: (A:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d6r1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r1ra1 a.98.1.1 (A:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq

SCOPe Domain Coordinates for d6r1ra1:

Click to download the PDB-style file with coordinates for d6r1ra1.
(The format of our PDB-style files is described here.)

Timeline for d6r1ra1: