SCOPe 2.08: Domain d5r1ra1: 5r1r A:1-221

Lineage for d5r1ra1 (5r1r A:1-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Escherichia coli [TaxId:562] [48171] (10 PDB entries)
   Uniprot Q08698

8. Domain d5r1ra1: 5r1r A:1-221 [18757]
   Other proteins in same PDB: d5r1ra2, d5r1rb2, d5r1rc2
   mutant

Details for d5r1ra1

PDB Entry: 5r1r, 3.1 Å

PDB Description: ribonucleotide reductase e441a mutant r1 protein from escherichia coli

PDB Compounds: (A:) ribonucleotide reductase r1 protein

SCOPe Domain Sequences for d5r1ra1:

Sequence; same for both SEQRES and ATOM records:

>d5r1ra1 a.98.1.1 (A:1-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
mnqnllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihe
tiikaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhll
edyteeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaacl
fsnypretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d5r1ra1:

• d5r1ra1 first appeared (with stable ids) in SCOP 1.55
  
• d5r1ra1 appears in SCOPe 2.07