SCOP 1.57: Domain d1r1rc1: 1r1r C:4-221

Lineage for d1r1rc1 (1r1r C:4-221)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (1 species)

7. Species Escherichia coli [TaxId:562] [48171] (8 PDB entries)

8. Domain d1r1rc1: 1r1r C:4-221 [18756]
   Other proteins in same PDB: d1r1ra2, d1r1rb2, d1r1rc2

Details for d1r1rc1

PDB Entry: 1r1r, 2.9 Å

PDB Description: ribonucleotide reductase r1 protein mutant y730f with a reduced active site from escherichia coli

SCOP Domain Sequences for d1r1rc1:

Sequence; same for both SEQRES and ATOM records:

>d1r1rc1 a.98.1.1 (C:4-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli}
nllvtkrdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetii
kaaadlisrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledy
teeefkqmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsn
ypretrlqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d1r1rc1:

• d1r1rc1 first appeared (with stable ids) in SCOP 1.55
  
• d1r1rc1 appears in SCOP 1.59
  
• d1r1rc1 appears in the current release, SCOPe 2.08