Lineage for d1rlra1 (1rlr A:10-221)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006379Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
    multihelical consists of two all-alpha subdomains
    subdomain 1 (residues 10-100) is a 4-helical bundle
  4. 2006380Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) (S)
  5. 2006381Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)
  6. 2006382Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)
  7. 2006383Species Escherichia coli [TaxId:562] [48171] (10 PDB entries)
    Uniprot Q08698
  8. 2006387Domain d1rlra1: 1rlr A:10-221 [18753]
    Other proteins in same PDB: d1rlra2

Details for d1rlra1

PDB Entry: 1rlr (more details), 2.5 Å

PDB Description: structure of ribonucleotide reductase protein r1
PDB Compounds: (A:) ribonucleotide reductase protein r1

SCOPe Domain Sequences for d1rlra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlra1 a.98.1.1 (A:10-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
rdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiikaaadl
isrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyteeefk
qmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsnypretr
lqyvkrfydavstfkislptpimsgvrtptrq

SCOPe Domain Coordinates for d1rlra1:

Click to download the PDB-style file with coordinates for d1rlra1.
(The format of our PDB-style files is described here.)

Timeline for d1rlra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlra2