SCOPe 2.08: Domain d1glna1: 1gln A:306-468

Lineage for d1glna1 (1gln A:306-468)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families)

5. Family a.97.1.1: C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48164] (1 protein)

6. Protein C-terminal domain of glutamyl-tRNA synthetase (GluRS) [48165] (1 species)

7. Species Thermus thermophilus [TaxId:274] [48166] (11 PDB entries)

8. Domain d1glna1: 1gln A:306-468 [18752]
   Other proteins in same PDB: d1glna2

Details for d1glna1

PDB Entry: 1gln, 2.5 Å

PDB Description: architectures of class-defining and specific domains of glutamyl-trna synthetase

PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d1glna1:

Sequence; same for both SEQRES and ATOM records:

>d1glna1 a.97.1.1 (A:306-468) C-terminal domain of glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
dleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfdtlkef
pekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfaaekgv
klgqvaqplraaltgsletpglfeilallgkeralrrlerala

Timeline for d1glna1:

• d1glna1 first appeared (with stable ids) in SCOP 1.55, called d1gln_1
  
• d1glna1 appears in SCOPe 2.07