SCOP 1.71: Domain d1dizb1: 1diz B:100-282

Lineage for d1dizb1 (1diz B:100-282)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)

6. Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)

7. Species Escherichia coli [TaxId:562] [48159] (3 PDB entries)

8. Domain d1dizb1: 1diz B:100-282 [18750]
   Other proteins in same PDB: d1diza2, d1dizb2
   protein/DNA complex; complexed with na, nri

Details for d1dizb1

PDB Entry: 1diz, 2.5 Å

PDB Description: crystal structure of e. coli 3-methyladenine dna glycosylase (alka) complexed with dna

SCOP Domain Sequences for d1dizb1:

Sequence; same for both SEQRES and ATOM records:

>d1dizb1 a.96.1.3 (B:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

Timeline for d1dizb1:

• d1dizb1 first appeared (with stable ids) in SCOP 1.55
  
• d1dizb1 appears in SCOP 1.69
  
• d1dizb1 appears in SCOP 1.73
  
• d1dizb1 appears in the current release, SCOPe 2.08