Lineage for d1dizb1 (1diz B:100-282)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5456Fold a.96: DNA-glycosylase [48149] (1 superfamily)
  4. 5457Superfamily a.96.1: DNA-glycosylase [48150] (3 families) (S)
  5. 5468Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)
  6. 5469Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 5470Species Escherichia coli [TaxId:562] [48159] (2 PDB entries)
  8. 5474Domain d1dizb1: 1diz B:100-282 [18750]
    Other proteins in same PDB: d1diza2, d1dizb2

Details for d1dizb1

PDB Entry: 1diz (more details), 2.5 Å

PDB Description: crystal structure of e. coli 3-methyladenine dna glycosylase (alka) complexed with dna

SCOP Domain Sequences for d1dizb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dizb1 a.96.1.3 (B:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOP Domain Coordinates for d1dizb1:

Click to download the PDB-style file with coordinates for d1dizb1.
(The format of our PDB-style files is described here.)

Timeline for d1dizb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dizb2