![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (5 families) ![]() |
![]() | Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins) |
![]() | Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [48159] (3 PDB entries) |
![]() | Domain d1mpgb1: 1mpg B:100-282 [18748] Other proteins in same PDB: d1mpga2, d1mpgb2 |
PDB Entry: 1mpg (more details), 1.8 Å
SCOP Domain Sequences for d1mpgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpgb1 a.96.1.3 (B:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli} aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp dea
Timeline for d1mpgb1: