Lineage for d1mpgb1 (1mpg B:100-282)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446243Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 446244Superfamily a.96.1: DNA-glycosylase [48150] (5 families) (S)
  5. 446278Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)
  6. 446279Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 446280Species Escherichia coli [TaxId:562] [48159] (3 PDB entries)
  8. 446282Domain d1mpgb1: 1mpg B:100-282 [18748]
    Other proteins in same PDB: d1mpga2, d1mpgb2

Details for d1mpgb1

PDB Entry: 1mpg (more details), 1.8 Å

PDB Description: 3-methyladenine dna glycosylase ii from escherichia coli

SCOP Domain Sequences for d1mpgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpgb1 a.96.1.3 (B:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOP Domain Coordinates for d1mpgb1:

Click to download the PDB-style file with coordinates for d1mpgb1.
(The format of our PDB-style files is described here.)

Timeline for d1mpgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mpgb2