![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
![]() | Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) |
![]() | Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [48159] (11 PDB entries) Uniprot P04395 |
![]() | Domain d1mpga1: 1mpg A:100-282 [18747] Other proteins in same PDB: d1mpga2, d1mpgb2 complexed with gol |
PDB Entry: 1mpg (more details), 1.8 Å
SCOPe Domain Sequences for d1mpga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp dea
Timeline for d1mpga1: