Lineage for d1mpga1 (1mpg A:100-282)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358646Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358647Superfamily a.96.1: DNA-glycosylase [48150] (5 families) (S)
  5. 358678Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)
  6. 358679Protein 3-Methyladenine DNA glycosylase II (gene alkA or aidA) [48158] (1 species)
  7. 358680Species Escherichia coli [TaxId:562] [48159] (2 PDB entries)
  8. 358681Domain d1mpga1: 1mpg A:100-282 [18747]
    Other proteins in same PDB: d1mpga2, d1mpgb2

Details for d1mpga1

PDB Entry: 1mpg (more details), 1.8 Å

PDB Description: 3-methyladenine dna glycosylase ii from escherichia coli

SCOP Domain Sequences for d1mpga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli}
aarpglrlpgcvdafeqgvrailgqlvsvamaakltarvaqlygerlddfpeyicfptpq
rlaaadpqalkalgmplkraealihlanaalegtlpmtipgdveqamktlqtfpgigrwt
anyfalrgwqakdvflpddylikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqp
dea

SCOP Domain Coordinates for d1mpga1:

Click to download the PDB-style file with coordinates for d1mpga1.
(The format of our PDB-style files is described here.)

Timeline for d1mpga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mpga2