Lineage for d1muda_ (1mud A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1497747Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1497748Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 1497756Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 1497757Protein Catalytic domain of MutY [48155] (2 species)
  7. 1497763Species Escherichia coli [TaxId:562] [48156] (13 PDB entries)
    Uniprot P17802 1-225
  8. 1497774Domain d1muda_: 1mud A: [18746]
    protein/DNA complex; complexed with ade, gol, sf4; mutant

Details for d1muda_

PDB Entry: 1mud (more details), 1.8 Å

PDB Description: catalytic domain of muty from escherichia coli, d138n mutant complexed to adenine
PDB Compounds: (A:) protein (adenine glycosylase)

SCOPe Domain Sequences for d1muda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muda_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpilngnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk

SCOPe Domain Coordinates for d1muda_:

Click to download the PDB-style file with coordinates for d1muda_.
(The format of our PDB-style files is described here.)

Timeline for d1muda_: