SCOPe 2.06: Domain d1muna_: 1mun A:

Lineage for d1muna_ (1mun A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Escherichia coli [TaxId:562] [48156] (13 PDB entries)
   Uniprot P17802 1-225

8. Domain d1muna_: 1mun A: [18744]
   complexed with gol, imd, sf4; mutant

Details for d1muna_

PDB Entry: 1mun, 1.2 Å

PDB Description: catalytic domain of muty from escherichia coli d138n mutant

PDB Compounds: (A:) adenine glycosylase

SCOPe Domain Sequences for d1muna_:

Sequence; same for both SEQRES and ATOM records:

>d1muna_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]}
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpilngnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk

Timeline for d1muna_:

• d1muna_ first appeared (with stable ids) in SCOP 1.55, called d1mun__
  
• d1muna_ appears in SCOPe 2.05
  
• d1muna_ appears in SCOPe 2.07
  
• d1muna_ appears in the current release, SCOPe 2.08