Lineage for d1mun__ (1mun -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.96: DNA-glycosylase [48149] (1 superfamily) Superfamily a.96.1: DNA-glycosylase [48150] (3 families) 
Family a.96.1.2: Catalytic domain of MutY [48154] (1 protein) Protein Catalytic domain of MutY [48155] (1 species) Species Escherichia coli [TaxId:562] [48156] (3 PDB entries) 
Domain d1mun__: 1mun - [18744]
Details for d1mun__
PDB Entry: 1mun (more details), 1.2 Å
PDB Description: catalytic domain of muty from escherichia coli d138n mutant
SCOP Domain Sequences for d1mun__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mun__ a.96.1.2 (-) Catalytic domain of MutY {Escherichia coli}
mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
tagailslslgkhfpilngnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk
SCOP Domain Coordinates for d1mun__:
Click to download the PDB-style file with coordinates for d1mun__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mun__:
- d1mun__ appears in SCOP 1.57
- d1mun__ appears in the current release, SCOPe 2.08, called d1muna_
View in 3D