SCOPe 2.08: Domain d2abka_: 2abk A:

Lineage for d2abka_ (2abk A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.1: Endonuclease III [48151] (1 protein)

6. Protein Endonuclease III [48152] (1 species)

7. Species Escherichia coli [TaxId:562] [48153] (4 PDB entries)

8. Domain d2abka_: 2abk A: [18743]
   complexed with sf4

Details for d2abka_

PDB Entry: 2abk, 1.85 Å

PDB Description: refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom

PDB Compounds: (A:) endonuclease III

SCOPe Domain Sequences for d2abka_:

Sequence; same for both SEQRES and ATOM records:

>d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]}
mnkakrleiltrlrennphpttelnfsspfelliavllsaqatdvsvnkataklypvant
paamlelgvegvktyiktiglynskaeniiktcrilleqhngevpedraalealpgvgrk
tanvvlntafgwptiavdthifrvcnrtqfapgknveqveekllkvvpaefkvdchhwli
lhgrytciarkprcgsciiedlceykekvdi

Timeline for d2abka_:

• d2abka_ first appeared (with stable ids) in SCOP 1.55, called d2abk__
  
• d2abka_ appears in SCOPe 2.07