Lineage for d2abka_ (2abk A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720979Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2720980Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2720981Family a.96.1.1: Endonuclease III [48151] (1 protein)
  6. 2720982Protein Endonuclease III [48152] (1 species)
  7. 2720983Species Escherichia coli [TaxId:562] [48153] (4 PDB entries)
  8. 2720985Domain d2abka_: 2abk A: [18743]
    complexed with sf4

Details for d2abka_

PDB Entry: 2abk (more details), 1.85 Å

PDB Description: refinement of the native structure of endonuclease iii to a resolution of 1.85 angstrom
PDB Compounds: (A:) endonuclease III

SCOPe Domain Sequences for d2abka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]}
mnkakrleiltrlrennphpttelnfsspfelliavllsaqatdvsvnkataklypvant
paamlelgvegvktyiktiglynskaeniiktcrilleqhngevpedraalealpgvgrk
tanvvlntafgwptiavdthifrvcnrtqfapgknveqveekllkvvpaefkvdchhwli
lhgrytciarkprcgsciiedlceykekvdi

SCOPe Domain Coordinates for d2abka_:

Click to download the PDB-style file with coordinates for d2abka_.
(The format of our PDB-style files is described here.)

Timeline for d2abka_: