Lineage for d1aa7b_ (1aa7 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5449Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
  4. 5450Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) (S)
  5. 5451Family a.95.1.1: Influenza virus matrix protein M1 [48146] (1 protein)
  6. 5452Protein Influenza virus matrix protein M1 [48147] (1 species)
  7. 5453Species Influenza virus [48148] (1 PDB entry)
  8. 5455Domain d1aa7b_: 1aa7 B: [18742]

Details for d1aa7b_

PDB Entry: 1aa7 (more details), 2.08 Å

PDB Description: influenza virus matrix protein crystal structure at ph 4.0

SCOP Domain Sequences for d1aa7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aa7b_ a.95.1.1 (B:) Influenza virus matrix protein M1 {Influenza virus}
slltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgilg
fvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsysa
galascmgliynrmgavttevafglvcatceqiadsq

SCOP Domain Coordinates for d1aa7b_:

Click to download the PDB-style file with coordinates for d1aa7b_.
(The format of our PDB-style files is described here.)

Timeline for d1aa7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aa7a_