![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily) multihelical; consists of two different all-alpha subdomains, 4 helices each |
![]() | Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family) ![]() superficially similar to membrane translocation domains automatically mapped to Pfam PF00598 |
![]() | Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins) |
![]() | Protein Influenza virus matrix protein M1 [48147] (1 species) bifunctional membrane/RNA-binding protein |
![]() | Species Influenza A virus, different strains [TaxId:11320] [48148] (2 PDB entries) |
![]() | Domain d1aa7a_: 1aa7 A: [18741] |
PDB Entry: 1aa7 (more details), 2.08 Å
SCOPe Domain Sequences for d1aa7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aa7a_ a.95.1.1 (A:) Influenza virus matrix protein M1 {Influenza A virus, different strains [TaxId: 11320]} mslltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsys agalascmgliynrmgavttevafglvcatceqiadsq
Timeline for d1aa7a_: