SCOPe 2.05: Domain d1aa7a_: 1aa7 A:

Lineage for d1aa7a_ (1aa7 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.95: Influenza virus matrix protein M1 [48144] (1 superfamily)
   multihelical; consists of two different all-alpha subdomains, 4 helices each

4. Superfamily a.95.1: Influenza virus matrix protein M1 [48145] (1 family)
   superficially similar to membrane translocation domains
   automatically mapped to Pfam PF00598

5. Family a.95.1.1: Influenza virus matrix protein M1 [48146] (2 proteins)

6. Protein Influenza virus matrix protein M1 [48147] (1 species)
   bifunctional membrane/RNA-binding protein

7. Species Influenza A virus [TaxId:11320] [48148] (2 PDB entries)

8. Domain d1aa7a_: 1aa7 A: [18741]

Details for d1aa7a_

PDB Entry: 1aa7, 2.08 Å

PDB Description: influenza virus matrix protein crystal structure at ph 4.0

PDB Compounds: (A:) influenza virus matrix protein

SCOPe Domain Sequences for d1aa7a_:

Sequence; same for both SEQRES and ATOM records:

>d1aa7a_ a.95.1.1 (A:) Influenza virus matrix protein M1 {Influenza A virus [TaxId: 11320]}
mslltevetyvlsiipsgplkaeiaqrledvfagkntdlevlmewlktrpilspltkgil
gfvftltvpserglqrrrfvqnalngngdpnnmdkavklyrklkreitfhgakeislsys
agalascmgliynrmgavttevafglvcatceqiadsq

Timeline for d1aa7a_:

• d1aa7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1aa7a_ appears in SCOPe 2.04
  
• d1aa7a_ appears in SCOPe 2.06
  
• d1aa7a_ appears in the current release, SCOPe 2.08