SCOPe 2.05: Domain d1ffkm_: 1ffk M:

Lineage for d1ffkm_ (1ffk M:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)
   automatically mapped to Pfam PF01280

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
   Uniprot P14119

8. Domain d1ffkm_: 1ffk M: [18740]
   Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
   complexed with cd, k, mg

Details for d1ffkm_

PDB Entry: 1ffk, 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

PDB Compounds: (M:) ribosomal protein l19

SCOPe Domain Sequences for d1ffkm_:

Sequence; same for both SEQRES and ATOM records:

>d1ffkm_ a.94.1.1 (M:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d1ffkm_:

• d1ffkm_ first appeared (with stable ids) in SCOP 1.55
  
• d1ffkm_ appears in SCOPe 2.04
  
• d1ffkm_ appears in SCOPe 2.06
  
• d1ffkm_ appears in the current release, SCOPe 2.08