Lineage for d1ffkm_ (1ffk M:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155088Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
  4. 155089Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 155090Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 155091Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 155092Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (7 PDB entries)
  8. 155095Domain d1ffkm_: 1ffk M: [18740]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffkm_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffkm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkm_ a.94.1.1 (M:) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOP Domain Coordinates for d1ffkm_:

Click to download the PDB-style file with coordinates for d1ffkm_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkm_: