Lineage for d1ddxd1 (1ddx D:3074-3583)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5391Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 5403Protein Prostaglandin H2 synthase [48136] (2 species)
  7. 5404Species Mouse (Mus musculus) [TaxId:10090] [48138] (7 PDB entries)
  8. 5424Domain d1ddxd1: 1ddx D:3074-3583 [18735]
    Other proteins in same PDB: d1ddxa2, d1ddxb2, d1ddxc2, d1ddxd2

Details for d1ddxd1

PDB Entry: 1ddx (more details), 3 Å

PDB Description: crystal structure of a mixture of arachidonic acid and prostaglandin bound to the cyclooxygenase active site of cox-2: prostaglandin structure

SCOP Domain Sequences for d1ddxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddxd1 a.93.1.2 (D:3074-3583) Prostaglandin H2 synthase {Mouse (Mus musculus)}
fltriklllkptpntvhyilthfkgvwnivnnipflrslimkyvltsrsylidspptynv
hygyksweafsnlsyytralppvaddcptpmgvkgnkelpdskevlekvllrrefipdpq
gsnmmfaffaqhfthqffktdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgkl
kyqviggevypptvkdtqvemiypphipenlqfavgqevfglvpglmmyatiwlrehnrv
cdilkqehpewgdeqlfqtsrliligetikiviedyvqhlsgyhfklkfdpellfnqqfq
yqnriasefntlyhwhpllpdtfniedqeysfkqflynnsillehgltqfvesftrqiag
rvaggrnvpiavqavakasidqsremkyqslneyrkrfslkpytsfeeltgekemaaelk
alysdidvmelypallvekprpdaifgetmvelgapfslkglmgnpicspqywkpstfgg
evgfkiintasiqslicnnvkgcpftsfnvq

SCOP Domain Coordinates for d1ddxd1:

Click to download the PDB-style file with coordinates for d1ddxd1.
(The format of our PDB-style files is described here.)

Timeline for d1ddxd1: