Lineage for d3pgha1 (3pgh A:74-583)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5391Family a.93.1.2: Myeloperoxidase-like [48132] (2 protein domains)
  6. 5403Protein Prostaglandin H2 synthase [48136] (2 species)
  7. 5404Species Mouse (Mus musculus) [TaxId:10090] [48138] (7 PDB entries)
  8. 5415Domain d3pgha1: 3pgh A:74-583 [18726]
    Other proteins in same PDB: d3pgha2, d3pghb2, d3pghc2, d3pghd2

Details for d3pgha1

PDB Entry: 3pgh (more details), 3 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non-selective inhibitor, flurbiprofen

SCOP Domain Sequences for d3pgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgha1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus)}
fltriklllkptpntvhyilthfkgvwnivnnipflrslimkyvltsrsylidspptynv
hygyksweafsnlsyytralppvaddcptpmgvkgnkelpdskevlekvllrrefipdpq
gsnmmfaffaqhfthqffktdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgkl
kyqviggevypptvkdtqvemiypphipenlqfavgqevfglvpglmmyatiwlrehqrv
cdilkqehpewgdeqlfqtskliligetikiviedyvqhlsgyhfklkfdpellfnqqfq
yqnriasefntlyhwhpllpdtfniedqeysfkqflynnsillehgltqfvesftrqiag
rvaggrnvpiavqavakasidqsremkyqslneyrkrfslkpytsfeeltgekemaaelk
alysdidvmelypallvekprpdaifgetmvelgapfslkglmgnpicspqywkpstfgg
evgfkiintasiqslicnnvkgcpftsfnvq

SCOP Domain Coordinates for d3pgha1:

Click to download the PDB-style file with coordinates for d3pgha1.
(The format of our PDB-style files is described here.)

Timeline for d3pgha1: