Lineage for d3pgha1 (3pgh A:74-583)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. 2002863Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 2002864Species Mouse (Mus musculus) [TaxId:10090] [48138] (12 PDB entries)
  8. 2002871Domain d3pgha1: 3pgh A:74-583 [18726]
    Other proteins in same PDB: d3pgha2, d3pghb2, d3pghc2, d3pghd2
    complexed with flp, hem, nag

Details for d3pgha1

PDB Entry: 3pgh (more details), 2.5 Å

PDB Description: cyclooxygenase-2 (prostaglandin synthase-2) complexed with a non-selective inhibitor, flurbiprofen
PDB Compounds: (A:) cyclooxygenase-2

SCOPe Domain Sequences for d3pgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgha1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]}
fltriklllkptpntvhyilthfkgvwnivnnipflrslimkyvltsrsylidspptynv
hygyksweafsnlsyytralppvaddcptpmgvkgnkelpdskevlekvllrrefipdpq
gsnmmfaffaqhfthqffktdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgkl
kyqviggevypptvkdtqvemiypphipenlqfavgqevfglvpglmmyatiwlrehqrv
cdilkqehpewgdeqlfqtskliligetikiviedyvqhlsgyhfklkfdpellfnqqfq
yqnriasefntlyhwhpllpdtfniedqeysfkqflynnsillehgltqfvesftrqiag
rvaggrnvpiavqavakasidqsremkyqslneyrkrfslkpytsfeeltgekemaaelk
alysdidvmelypallvekprpdaifgetmvelgapfslkglmgnpicspqywkpstfgg
evgfkiintasiqslicnnvkgcpftsfnvq

SCOPe Domain Coordinates for d3pgha1:

Click to download the PDB-style file with coordinates for d3pgha1.
(The format of our PDB-style files is described here.)

Timeline for d3pgha1: