Lineage for d1cvua1 (1cvu A:74-583)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. Family a.93.1.2: Myeloperoxidase-like [48132] (3 proteins)
  6. Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. Species Mouse (Mus musculus) [TaxId:10090] [48138] (13 PDB entries)
  8. Domain d1cvua1: 1cvu A:74-583 [18716]
    Other proteins in same PDB: d1cvua2, d1cvub2
    complexed with acd, bog, nag

Details for d1cvua1

PDB Entry: 1cvu (more details), 2.4 Å

PDB Description: crystal structure of arachidonic acid bound to the cyclooxygenase active site of cox-2
PDB Compounds: (A:) prostaglandin h2 synthase-2

SCOPe Domain Sequences for d1cvua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]}
fltriklllkptpntvhyilthfkgvwnivnnipflrslimkyvltsrsylidspptynv
hygyksweafsnlsyytralppvaddcptpmgvkgnkelpdskevlekvllrrefipdpq
gsnmmfaffaqhftaqffktdhkrgpgftrglghgvdlnhiygetldrqhklrlfkdgkl
kyqviggevypptvkdtqvemiypphipenlqfavgqevfglvpglmmyatiwlrehqrv
cdilkqehpewgdeqlfqtskliligetikiviedyvqhlsgyhfklkfdpellfnqqfq
yqnriasefntlyhwhpllpdtfniedqeysfkqflynnsillehgltqfvesftrqiag
rvaggrnvpiavqavakasidqsremkyqslneyrkrfslkpytsfeeltgekemaaelk
alysdidvmelypallvekprpdaifgetmvelgapfslkglmgnpicspqywkpstfgg
evgfkiintasiqslicnnvkgcpftsfnvq

SCOPe Domain Coordinates for d1cvua1 are not available.

Timeline for d1cvua1:

Domains from same chain:
(mouse over for more information)
d1cvua2
Domains from other chains:
(mouse over for more information)
d1cvub1, d1cvub2