Lineage for d1pgfa1 (1pgf A:74-583)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002843Family a.93.1.2: Myeloperoxidase-like [48132] (3 protein domains)
  6. 2002863Protein Prostaglandin H2 synthase [48136] (2 species)
    contains EGF-like module
  7. 2002906Species Sheep (Ovis aries) [TaxId:9940] [48137] (23 PDB entries)
    Uniprot P05979 32-584
  8. 2002942Domain d1pgfa1: 1pgf A:74-583 [18714]
    Other proteins in same PDB: d1pgfa2, d1pgfb2
    complexed with hem, imm, nag

Details for d1pgfa1

PDB Entry: 1pgf (more details), 4.5 Å

PDB Description: prostaglandin h2 synthase-1 complexed with 1-(4-iodobenzoyl)-5-methoxy-2-methylindole-3-acetic acid (iodoindomethacin), cis model
PDB Compounds: (A:) prostaglandin h2 synthase-1

SCOPe Domain Sequences for d1pgfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pgfa1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvp

SCOPe Domain Coordinates for d1pgfa1:

Click to download the PDB-style file with coordinates for d1pgfa1.
(The format of our PDB-style files is described here.)

Timeline for d1pgfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pgfa2