Lineage for d1ebva1 (1ebv A:74-583)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5391Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 5403Protein Prostaglandin H2 synthase [48136] (2 species)
  7. 5429Species Sheep (Ovis aries) [TaxId:9940] [48137] (8 PDB entries)
  8. 5434Domain d1ebva1: 1ebv A:74-583 [18709]
    Other proteins in same PDB: d1ebva2

Details for d1ebva1

PDB Entry: 1ebv (more details), 3.2 Å

PDB Description: ovine pghs-1 complexed with salicyl hydroxamic acid

SCOP Domain Sequences for d1ebva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebva1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Sheep (Ovis aries)}
iwtwlrttlrpspsfihfllthgrwlwdfvnatfirdtlmrlvltvrsnlipspptynia
hdyiswesfsnvsyytrilpsvprdcptpmgtkgkkqlpdaeflsrrfllrrkfipdpqg
tnlmfaffaqhfthqffktsgkmgpgftkalghgvdlghiygdnlerqyqlrlfkdgklk
yqmlngevyppsveeapvlmhyprgippqsqmavgqevfgllpglmlyatiwlrehnrvc
dllkaehptwgdeqlfqtarliligetikivieeyvqqlsgyflqlkfdpellfgaqfqy
rnriamefnqlyhwhplmpdsfrvgpqdysyeqflfntsmlvdygvealvdafsrqpagr
igggrnidhhilhvavdvikesrvlrlqpfneyrkrfgmkpytsfqeltgekemaaelee
lygdidalefypglllekchpnsifgesmiemgapfslkgllgnpicspeywkastfgge
vgfnlvktatlkklvclntktcpyvsfhvp

SCOP Domain Coordinates for d1ebva1:

Click to download the PDB-style file with coordinates for d1ebva1.
(The format of our PDB-style files is described here.)

Timeline for d1ebva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ebva2