Lineage for d1myp.2 (1myp B:,D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5391Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 5392Protein Myeloperoxidase [48133] (2 species)
  7. 5393Species Dog (Canis familiaris) [TaxId:9615] [48135] (1 PDB entry)
  8. 5395Domain d1myp.2: 1myp B:,D: [18702]

Details for d1myp.2

PDB Entry: 1myp (more details), 3 Å

PDB Description: x-ray crystal structure of canine myeloperoxidase at 3 angstroms resolution

SCOP Domain Sequences for d1myp.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1myp.2 a.93.1.2 (B:,D:) Myeloperoxidase {Dog (Canis familiaris)}
cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepaXncetscvqqppcfpl
kippndpriknqadcipffrscpacpgsnitirnqinaltsfvdasmvygseeplarnlr
nmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripcflagdtrssempelts
mhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiityrdylplvlgptamrk
ylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqpmepnprvplsrvffas
wrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmrigldlpalnmqrsrdh
glpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpnnidiwmggvseplkrk
grvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqislpriicdntgittvsk
nnifmsnsyprdfvncstlpalnlasw

SCOP Domain Coordinates for d1myp.2:

Click to download the PDB-style file with coordinates for d1myp.2.
(The format of our PDB-style files is described here.)

Timeline for d1myp.2: