Lineage for d1cxp.2 (1cxp B:,D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5391Family a.93.1.2: Myeloperoxidase-like [48132] (2 proteins)
  6. 5392Protein Myeloperoxidase [48133] (2 species)
  7. 5396Species Human (Homo sapiens) [TaxId:9606] [48134] (3 PDB entries)
  8. 5398Domain d1cxp.2: 1cxp B:,D: [18696]

Details for d1cxp.2

PDB Entry: 1cxp (more details), 1.8 Å

PDB Description: cryogenic crystal structure of human myeloperoxidase isoform c

SCOP Domain Sequences for d1cxp.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1cxp.2 a.93.1.2 (B:,D:) Myeloperoxidase {Human (Homo sapiens)}
cpeqdkyrtitgmcnnrrsptlgasnrafvrwlpaeyedgfslpygwtpgvkrngfpval
aravsneivrfptdqltpdqerslmfmqwgqlldhdldftpepaXvncetscvqqppcfp
lkippndpriknqadcipffrscpacpgsnitirnqinaltsfvdasmvygseeplarnl
rnmsnqlgllavnqrfqdngrallpfdnlhddpclltnrsaripcflagdtrssempelt
smhtlllrehnrlatelkslnprwdgerlyqearkivgamvqiityrdylplvlgptamr
kylptyrsyndsvdprianvftnafryghtliqpfmfrldnryqpmepnprvplsrvffa
swrvvleggidpilrglmatpaklnrqnqiavdeirerlfeqvmrigldlpalnmqrsrd
hglpgynawrrfcglpqpetvgqlgtvlrnlklarklmeqygtpnnidiwmggvseplkr
kgrvgpllaciigtqfrklrdgdrfwwenegvfsmqqrqalaqislpriicdntgittvs
knnifmsnsyprdfvncstlpalnlaswrea

SCOP Domain Coordinates for d1cxp.2:

Click to download the PDB-style file with coordinates for d1cxp.2.
(The format of our PDB-style files is described here.)

Timeline for d1cxp.2: