Lineage for d1qo4a1 (1qo4 A:1-305)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2328533Protein Plant peroxidase [48125] (6 species)
  7. 2328582Species Thale cress (Arabidopsis thaliana), peroxidase A2 [TaxId:3702] [48131] (2 PDB entries)
  8. 2328584Domain d1qo4a1: 1qo4 A:1-305 [18694]
    Other proteins in same PDB: d1qo4a2
    complexed with ca, hem

Details for d1qo4a1

PDB Entry: 1qo4 (more details), 3 Å

PDB Description: arabidopsis thaliana peroxidase a2 at room temperature
PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1qo4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo4a1 a.93.1.1 (A:1-305) Plant peroxidase {Thale cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]}
qlnatfysgtcpnasaivrstiqqalqsdtrigaslirlhfhdcfvngcdasillddtgs
iqseknagpnvnsargfnvvdniktalenacpgvvscsdvlalaseasvslaggpswtvl
lgrrdsltanlaganssipspieslsnitfkfsavglntndlvalsgahtfgrarcgvfn
nrlfnfsgtgnpdptlnstllstlqqlcpqngsastitnldlstpdafdnnyfanlqsnd
gllqsdqelfsttgsstiaivtsfasnqtlffqafaqsminmgnispltgsngeirldck
kvngs

SCOPe Domain Coordinates for d1qo4a1:

Click to download the PDB-style file with coordinates for d1qo4a1.
(The format of our PDB-style files is described here.)

Timeline for d1qo4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qo4a2