![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (4 proteins) |
![]() | Protein Plant peroxidase [48125] (6 species) |
![]() | Species Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId:3702] [48130] (1 PDB entry) |
![]() | Domain d1qgjb_: 1qgj B: [18692] complexed with ca, gsh, hem |
PDB Entry: 1qgj (more details), 1.9 Å
SCOP Domain Sequences for d1qgjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgjb_ a.93.1.1 (B:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} qlspdiyakscpnlvqivrkqvaialkaeirmaaslirlhfhdcfvngcdasllldgads eklaipninsargfevidtikaavenacpgvvscadiltlaardsvvlsggpgwrvalgr kdglvanqnsannlpspfepldaiiakfvavnlnitdvvalsgahtfgqakcavfsnrlf nftgagnpdatletsllsnlqtvcplggnsnitapldrsttdtfdnnyfknllegkglls sdqilfssdlavnttkklveaysrsqslffrdftcamirmgnisngasgevrtncrvinn
Timeline for d1qgjb_: