Lineage for d1qgjb_ (1qgj B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) Protein Plant peroxidase [48125] (6 species) 
Species Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId:3702] [48130] (1 PDB entry) 
Domain d1qgjb_: 1qgj B: [18692]
Details for d1qgjb_
PDB Entry: 1qgj (more details), 1.9 Å
PDB Description: arabidopsis thaliana peroxidase n
SCOP Domain Sequences for d1qgjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgjb_ a.93.1.1 (B:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N}
qlspdiyakscpnlvqivrkqvaialkaeirmaaslirlhfhdcfvngcdasllldgads
eklaipninsargfevidtikaavenacpgvvscadiltlaardsvvlsggpgwrvalgr
kdglvanqnsannlpspfepldaiiakfvavnlnitdvvalsgahtfgqakcavfsnrlf
nftgagnpdatletsllsnlqtvcplggnsnitapldrsttdtfdnnyfknllegkglls
sdqilfssdlavnttkklveaysrsqslffrdftcamirmgnisngasgevrtncrvinn
SCOP Domain Coordinates for d1qgjb_:
Click to download the PDB-style file with coordinates for d1qgjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qgjb_:
- d1qgjb_ appears in SCOP 1.57
- d1qgjb_ appears in the current release, SCOPe 2.08
View in 3D
