Lineage for d1qgja_ (1qgj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720260Protein Plant peroxidase [48125] (6 species)
  7. 2720312Species Thale cress (Arabidopsis thaliana), peroxidase N [TaxId:3702] [48130] (1 PDB entry)
  8. 2720313Domain d1qgja_: 1qgj A: [18691]
    complexed with ca, gsh, hem

Details for d1qgja_

PDB Entry: 1qgj (more details), 1.9 Å

PDB Description: arabidopsis thaliana peroxidase n
PDB Compounds: (A:) peroxidase n

SCOPe Domain Sequences for d1qgja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgja_ a.93.1.1 (A:) Plant peroxidase {Thale cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]}
qlspdiyakscpnlvqivrkqvaialkaeirmaaslirlhfhdcfvngcdasllldgads
eklaipninsargfevidtikaavenacpgvvscadiltlaardsvvlsggpgwrvalgr
kdglvanqnsannlpspfepldaiiakfvavnlnitdvvalsgahtfgqakcavfsnrlf
nftgagnpdatletsllsnlqtvcplggnsnitapldrsttdtfdnnyfknllegkglls
sdqilfssdlavnttkklveaysrsqslffrdftcamirmgnisngasgevrtncrvinn

SCOPe Domain Coordinates for d1qgja_:

Click to download the PDB-style file with coordinates for d1qgja_.
(The format of our PDB-style files is described here.)

Timeline for d1qgja_: