Lineage for d1fhfb_ (1fhf B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333359Protein Plant peroxidase [48125] (6 species)
  7. 2333404Species Soybean (Glycine max) [TaxId:3847] [48128] (1 PDB entry)
  8. 2333406Domain d1fhfb_: 1fhf B: [18688]
    complexed with ca, hem, trs

Details for d1fhfb_

PDB Entry: 1fhf (more details), 2.8 Å

PDB Description: the structure of soybean peroxidase
PDB Compounds: (B:) seed coat peroxidase

SCOPe Domain Sequences for d1fhfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhfb_ a.93.1.1 (B:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]}
qltptfyretcpnlfpivfgvifdasftdprigaslmrlhfhdcfvqgcdgsvllnntdt
ieseqdalpninsirgldvvndiktavenscpdtvscadilaiaaeiasvlgggpgwpvp
lgrrdsltanrtlanqnlpapffnltqlkasfavqglntldlvtlsgghtfgrarcstfi
nrlynfsntgnpdptlnttylevlrarcpqnatgdnltnldlstpdqfdnryysnllqln
gllqsdqelfstpgadtipivnsfssnqntffsnfrvsmikmgnigvltgdegeirlqcn
fvng

SCOPe Domain Coordinates for d1fhfb_:

Click to download the PDB-style file with coordinates for d1fhfb_.
(The format of our PDB-style files is described here.)

Timeline for d1fhfb_: