SCOPe 2.06: Domain d1fhfa_: 1fhf A:

Lineage for d1fhfa_ (1fhf A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Plant peroxidase [48125] (6 species)

7. Species Soybean (Glycine max) [TaxId:3847] [48128] (1 PDB entry)

8. Domain d1fhfa_: 1fhf A: [18687]
   complexed with ca, hem, trs

Details for d1fhfa_

PDB Entry: 1fhf, 2.8 Å

PDB Description: the structure of soybean peroxidase

PDB Compounds: (A:) seed coat peroxidase

SCOPe Domain Sequences for d1fhfa_:

Sequence; same for both SEQRES and ATOM records:

>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]}
qltptfyretcpnlfpivfgvifdasftdprigaslmrlhfhdcfvqgcdgsvllnntdt
ieseqdalpninsirgldvvndiktavenscpdtvscadilaiaaeiasvlgggpgwpvp
lgrrdsltanrtlanqnlpapffnltqlkasfavqglntldlvtlsgghtfgrarcstfi
nrlynfsntgnpdptlnttylevlrarcpqnatgdnltnldlstpdqfdnryysnllqln
gllqsdqelfstpgadtipivnsfssnqntffsnfrvsmikmgnigvltgdegeirlqcn
fvng

Timeline for d1fhfa_:

• d1fhfa_ first appeared (with stable ids) in SCOP 1.55
  
• d1fhfa_ appears in SCOPe 2.05
  
• d1fhfa_ appears in SCOPe 2.07
  
• d1fhfa_ appears in the current release, SCOPe 2.08