Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein Plant peroxidase [48125] (6 species) |
Species Soybean (Glycine max) [TaxId:3847] [48128] (1 PDB entry) |
Domain d1fhfa_: 1fhf A: [18687] complexed with ca, hem, trs |
PDB Entry: 1fhf (more details), 2.8 Å
SCOPe Domain Sequences for d1fhfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} qltptfyretcpnlfpivfgvifdasftdprigaslmrlhfhdcfvqgcdgsvllnntdt ieseqdalpninsirgldvvndiktavenscpdtvscadilaiaaeiasvlgggpgwpvp lgrrdsltanrtlanqnlpapffnltqlkasfavqglntldlvtlsgghtfgrarcstfi nrlynfsntgnpdptlnttylevlrarcpqnatgdnltnldlstpdqfdnryysnllqln gllqsdqelfstpgadtipivnsfssnqntffsnfrvsmikmgnigvltgdegeirlqcn fvng
Timeline for d1fhfa_: