Lineage for d1fhfa_ (1fhf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2720260Protein Plant peroxidase [48125] (6 species)
  7. 2720305Species Soybean (Glycine max) [TaxId:3847] [48128] (1 PDB entry)
  8. 2720306Domain d1fhfa_: 1fhf A: [18687]
    complexed with ca, hem, trs

Details for d1fhfa_

PDB Entry: 1fhf (more details), 2.8 Å

PDB Description: the structure of soybean peroxidase
PDB Compounds: (A:) seed coat peroxidase

SCOPe Domain Sequences for d1fhfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]}
qltptfyretcpnlfpivfgvifdasftdprigaslmrlhfhdcfvqgcdgsvllnntdt
ieseqdalpninsirgldvvndiktavenscpdtvscadilaiaaeiasvlgggpgwpvp
lgrrdsltanrtlanqnlpapffnltqlkasfavqglntldlvtlsgghtfgrarcstfi
nrlynfsntgnpdptlnttylevlrarcpqnatgdnltnldlstpdqfdnryysnllqln
gllqsdqelfstpgadtipivnsfssnqntffsnfrvsmikmgnigvltgdegeirlqcn
fvng

SCOPe Domain Coordinates for d1fhfa_:

Click to download the PDB-style file with coordinates for d1fhfa_.
(The format of our PDB-style files is described here.)

Timeline for d1fhfa_: