Lineage for d1schb_ (1sch B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002721Protein Plant peroxidase [48125] (6 species)
  7. 2002763Species Peanut (Arachis hypogaea) [TaxId:3818] [48127] (1 PDB entry)
  8. 2002765Domain d1schb_: 1sch B: [18686]
    complexed with ca, hem, nag

Details for d1schb_

PDB Entry: 1sch (more details), 2.56 Å

PDB Description: peanut peroxidase
PDB Compounds: (B:) peanut peroxidase, major cationic isozyme

SCOPe Domain Sequences for d1schb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1schb_ a.93.1.1 (B:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]}
elssnfyatkcpnalstiksavnsavakearmgasllrlhfhdcfvqgcdasvllddtsn
ftgektagpnansirgfevidtiksqveslcpgvvscadilavaardsvvalggaswnvl
lgrrdsttaslssansdlpapffnlsglisafsnkgfttkelvtlsgahtigqaqctafr
triynesnidptyakslqancpsvggdtnlspfdvttpnkfdnayyinlrnkkgllhsdq
qlfngvstdsqvtaysnnaatfntdfgnamikmgnlspltgtsgqirtncrktn

SCOPe Domain Coordinates for d1schb_:

Click to download the PDB-style file with coordinates for d1schb_.
(The format of our PDB-style files is described here.)

Timeline for d1schb_: