Lineage for d1scha_ (1sch A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5256Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 5362Protein Plant peroxidase [48125] (6 species)
  7. 5384Species Peanut (Arachis hypogaea) [TaxId:3818] [48127] (1 PDB entry)
  8. 5385Domain d1scha_: 1sch A: [18685]

Details for d1scha_

PDB Entry: 1sch (more details), 2.7 Å

PDB Description: peanut peroxidase

SCOP Domain Sequences for d1scha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea)}
elssnfyatkcpnalstiksavnsavakearmgasllrlhfhdcfvqgcdasvllddtsn
ftgektagpnansirgfevidtiksqveslcpgvvscadilavaardsvvalggaswnvl
lgrrdsttaslssansdlpapffnlsglisafsnkgfttkelvtlsgahtigqaqctafr
triynesnidptyakslqancpsvggdtnlspfdvttpnkfdnayyinlrnkkgllhsdq
qlfngvstdsqvtaysnnaatfntdfgnamikmgnlspltgtsgqirtncrktn

SCOP Domain Coordinates for d1scha_:

Click to download the PDB-style file with coordinates for d1scha_.
(The format of our PDB-style files is described here.)

Timeline for d1scha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1schb_