Lineage for d1scha_ (1sch A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) Protein Plant peroxidase [48125] (6 species) 
Species Peanut (Arachis hypogaea) [TaxId:3818] [48127] (1 PDB entry) 
Domain d1scha_: 1sch A: [18685]
Details for d1scha_
PDB Entry: 1sch (more details), 2.7 Å
PDB Description: peanut peroxidase
SCOP Domain Sequences for d1scha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea)}
elssnfyatkcpnalstiksavnsavakearmgasllrlhfhdcfvqgcdasvllddtsn
ftgektagpnansirgfevidtiksqveslcpgvvscadilavaardsvvalggaswnvl
lgrrdsttaslssansdlpapffnlsglisafsnkgfttkelvtlsgahtigqaqctafr
triynesnidptyakslqancpsvggdtnlspfdvttpnkfdnayyinlrnkkgllhsdq
qlfngvstdsqvtaysnnaatfntdfgnamikmgnlspltgtsgqirtncrktn
SCOP Domain Coordinates for d1scha_:
Click to download the PDB-style file with coordinates for d1scha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1scha_:
- d1scha_ appears in SCOP 1.57
- d1scha_ appears in the current release, SCOPe 2.08
View in 3D
