Lineage for d1scha_ (1sch A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2328533Protein Plant peroxidase [48125] (6 species)
  7. 2328575Species Peanut (Arachis hypogaea) [TaxId:3818] [48127] (1 PDB entry)
  8. 2328576Domain d1scha_: 1sch A: [18685]
    complexed with ca, hem, nag

Details for d1scha_

PDB Entry: 1sch (more details), 2.56 Å

PDB Description: peanut peroxidase
PDB Compounds: (A:) peanut peroxidase, major cationic isozyme

SCOPe Domain Sequences for d1scha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]}
elssnfyatkcpnalstiksavnsavakearmgasllrlhfhdcfvqgcdasvllddtsn
ftgektagpnansirgfevidtiksqveslcpgvvscadilavaardsvvalggaswnvl
lgrrdsttaslssansdlpapffnlsglisafsnkgfttkelvtlsgahtigqaqctafr
triynesnidptyakslqancpsvggdtnlspfdvttpnkfdnayyinlrnkkgllhsdq
qlfngvstdsqvtaysnnaatfntdfgnamikmgnlspltgtsgqirtncrktn

SCOPe Domain Coordinates for d1scha_:

Click to download the PDB-style file with coordinates for d1scha_.
(The format of our PDB-style files is described here.)

Timeline for d1scha_: