Lineage for d1atjf_ (1atj F:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154837Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 154838Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 154839Family a.93.1.1: CCP-like [48114] (6 proteins)
  6. 154965Protein Plant peroxidase [48125] (6 species)
  7. 154968Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (21 PDB entries)
  8. 154996Domain d1atjf_: 1atj F: [18684]

Details for d1atjf_

PDB Entry: 1atj (more details), 2.15 Å

PDB Description: recombinant horseradish peroxidase c1a

SCOP Domain Sequences for d1atjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atjf_ a.93.1.1 (F:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOP Domain Coordinates for d1atjf_:

Click to download the PDB-style file with coordinates for d1atjf_.
(The format of our PDB-style files is described here.)

Timeline for d1atjf_: