Lineage for d1atjf_ (1atj F:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49663Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 49664Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 49665Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 49778Protein Plant peroxidase [48125] (6 species)
  7. 49781Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (5 PDB entries)
  8. 49793Domain d1atjf_: 1atj F: [18684]

Details for d1atjf_

PDB Entry: 1atj (more details), 2.15 Å

PDB Description: recombinant horseradish peroxidase c1a

SCOP Domain Sequences for d1atjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1atjf_ a.93.1.1 (F:) Plant peroxidase {Horseradish (Armoracia rusticana)}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOP Domain Coordinates for d1atjf_:

Click to download the PDB-style file with coordinates for d1atjf_.
(The format of our PDB-style files is described here.)

Timeline for d1atjf_: